PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10009263
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family MYB_related
Protein Properties Length: 139aa    MW: 15995.6 Da    PI: 8.7752
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10009263genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.91e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l++ ++++G g+W+++++  g+ R++k+c++rw +yl
      Lus10009263 14 KGLWSPEEDEKLLRHITKFGHGCWSSVPKQAGLQRCGKSCRLRWINYL 61
                     678*******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-28664IPR009057Homeodomain-like
PROSITE profilePS5129424.527965IPR017930Myb domain
SMARTSM007179.4E-131363IPR001005SANT/Myb domain
PfamPF002491.1E-151461IPR001005SANT/Myb domain
SuperFamilySSF466894.05E-221688IPR009057Homeodomain-like
CDDcd001674.49E-111761No hitNo description
PROSITE profilePS500903.90362116IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.0E-86588IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 139 aa     Download sequence    Send to blast
MGRHSCCYKQ KLRKGLWSPE EDEKLLRHIT KFGHGCWSSV PKQAGLQRCG KSCRLRWINY  60
LRPDLKRGAF SQQEENLIIE LHAVLGNRML CFFGFVMLCI LFLFQVVSNC GAVAWKDGQR  120
DKESVEFLLE KEASAERD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-16128825100MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012490265.11e-61PREDICTED: transcription factor MYB86
SwissprotQ8LPH61e-54MYB86_ARATH; Transcription factor MYB86
TrEMBLA0A0D2SIE11e-61A0A0D2SIE1_G
STRINGPOPTR_0014s10680.15e-60(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108333103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.33e-61myb domain protein 55